04017nam 22006734a 450 991014427320332120190710151742.01-281-08787-497866110878763-527-60943-13-527-60871-0(CKB)1000000000376657(EBL)481425(OCoLC)163578005(SSID)ssj0000121601(PQKBManifestationID)11147910(PQKBTitleCode)TC0000121601(PQKBWorkID)10109423(PQKB)10985858(MiAaPQ)EBC481425(EXLCZ)99100000000037665720060125d2006 uy 0engur|n|---|||||txtccrChirality in drug research[electronic resource] /edited by Eric Francotte and Wolfgang LindnerWeinheim Wiley-VCHc20061 online resource (373 p.)Methods and principles in medicinal chemistry ;v. 33Description based upon print version of record.3-527-31076-2 Includes bibliographical references and index.Chiral drugs from a historical point of view / Joseph Gal -- Stereoselective synthesis of drugs : an industrial perspective / Hans-Jürgen Federsel -- Aspects of chirality in natural products drug discovery / Philipp Krastel, Frank Petersen, Silvio Roggo, Esther Schmitt, Ansgar Schuffenhauer -- Biotransformation methods for preparing chiral drugs and drug intermediates / Michael Müller, Marcel Wubbolts -- Resolution of chiral drugs and drug intermediates by crystallisation / Kazuhiko Saigo and Kenichi Sakai -- Isolation and production of optically pure drugs by enantioselective chromatography / Eric Francotte -- Stereoselective chromatographic methods for drug analysis / Norbert M. Maier, Wolfgang Lindner -- Capillary electrophoresis coupled to mass spectrometry for chiral drugs analysis / Serge Rudaz, Jean-Luc Veuthey -- Powerful chiral molecular tools for preparation of enantiopure alcohols and simultaneous determination of their absolute configurations by X-ray crystallography and/or p1 sH NMR anisotropy methods / Nobuyuki Harada -- Keywords in chirality modeling : molecular modeling of chirality : software and literature research on chirality in modeling, chirality in docking, chiral ligand-receptor interaction and symmetry / Gerd Folkers, Mine Yarim, Pavel Pospisil.Divided into the three main sections of synthesis, analysis and drug development, this handbook covers all stages of the drug development process, including large-scale synthesis and purification of chirally pure pharmaceuticals. The two editors from academia and a major pharmaceutical company have assembled an experienced, international team who provide first-hand practical advice and report previously unpublished data.In the first section, the isolation of chiral drugs from natural sources, their production in enzymatic processes and the resolution of racemic mixtures in preparativeMethods and principles in medicinal chemistry ;v. 33.Chiral drugsDrugsResearchDrug developmentMédicamentsRechercheMédicamentsDéveloppementElectronic books.legemidlerforskninglegemiddelutviklinglegemiddelanalysefarmasøytisk kjemimedikamentermedisinerlegemiddelkjemisynteseChiral drugs.DrugsResearch.Drug development.MédicamentsRecherche.MédicamentsDéveloppement.615.19Francotte Eric932849Lindner W(Wolfgang)932850MiAaPQMiAaPQMiAaPQBOOK9910144273203321Chirality in drug research2099647UNINA